PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_7DL_70D4FDB2A.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family bZIP
Protein Properties Length: 196aa    MW: 21262.8 Da    PI: 7.3824
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_7DL_70D4FDB2A.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.61.2e-0783129551
                            CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                 bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                             + rr   NR A r++R++Kk+ ++ L+e+++ L a N++L k+++ 
  Traes_7DL_70D4FDB2A.1  83 SKKRRPSGNRAAVRKYREKKKEHTAVLQEEAARLRAMNEQLTKKVQD 129
                            56677788*********************************999874 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.9E-773146IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1702.9E-1381147No hitNo description
PROSITE profilePS502178.70381128IPR004827Basic-leucine zipper domain
PfamPF077164.7E-1283128IPR004827Basic-leucine zipper domain
CDDcd146864.11E-1184129No hitNo description
SuperFamilySSF579592.39E-691145No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MDDGDLDFSS MSMGSYFDDV LGGAAEHLAC CTHTHTCNPP AHDLPHSHTC HHVHSKLAAS  60
ASSDAAAADS PTEPEDAHAT SRSKKRRPSG NRAAVRKYRE KKKEHTAVLQ EEAARLRAMN  120
EQLTKKVQDH AALEAEAARL RCLLVDVRGR IEGEIGAFPY QRRPAKGDGP GSAGPVMMSS  180
CGFVRTCEQP PVCFHH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
195103RKYREKKKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3547351e-167AK354735.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1010J17.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006656494.17e-69PREDICTED: uncharacterized protein LOC102721653
SwissprotQ8GTS25e-53BZP23_ARATH; Basic leucine zipper 23
TrEMBLW5I0I01e-144W5I0I0_WHEAT; Uncharacterized protein
STRINGBRADI1G30140.14e-68(Brachypodium distachyon)
STRINGSi037105m3e-68(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP41753572
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.12e-45bZIP family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]